PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy007414
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family NF-YB
Protein Properties Length: 152aa    MW: 16909.7 Da    PI: 6.7957
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59537527PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB178.46.5e-5614109297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                ++qdrflPianvsrimkk+lP nakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plk+yl++yre+eg+k
  Ahy007414  14 EQQDRFLPIANVSRIMKKALPPNAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKLYLNNYRETEGDK 109
                579*******************************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.2E-539117IPR009072Histone-fold
SuperFamilySSF471132.95E-4116126IPR009072Histone-fold
PfamPF008084.5E-281983IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006158.6E-194765No hitNo description
PROSITE patternPS0068505066IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006158.6E-196684No hitNo description
PRINTSPR006158.6E-1985103No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 152 aa     Download sequence    Send to blast
PTSGNISDSS SSKEQQDRFL PIANVSRIMK KALPPNAKIS KEAKETVQEC VSEFISFITG  60
EASDKCQREK RKTINGDDLL WAMTTLGFEN YVGPLKLYLN NYRETEGDKT SMPVNHHHHH  120
HSPEPNNHHH GVADFAGFNG NNNDGGFYSV GP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B4e-4815104392Transcription factor HapC (Eurofung)
4g92_B4e-4815104392Transcription factor HapC (Eurofung)
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015956005.11e-112PREDICTED: nuclear transcription factor Y subunit B-like
SwissprotO233105e-62NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0L9TJC31e-76A0A0L9TJC3_PHAAN; Uncharacterized protein
STRINGGLYMA08G14931.14e-75(Glycine max)